General Information

  • ID:  hor006679
  • Uniprot ID:  Q8UW80
  • Protein name:  Progonadoliberin-1
  • Gene name:  gnrh1
  • Organism:  Verasper moseri (Barfin flounder)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  Preoptic area of the brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Verasper (genus), Pleuronectidae (family), Pleuronectoidei (suborder), Pleuronectiformes (order), Carangaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSYGLSPGGKRQLDSLSQTLGNVVEEFPRVDSPCSVLGGAEESPFAGIYRMKGFLGSITDRGNRTQNI
  • Length:  70
  • Propeptide:  MHRKMAVKTLSVWLLLVGTLVPQHCCQHWSYGLSPGGKRQLDSLSQTLGNVVEEFPRVDSPCSVLGGAEESPFAGIYRMKGFLGSITDRGNRTQNI
  • Signal peptide:  MHRKMAVKTLSVWLLLVGTLVPQHCC
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8UW80-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006679_AF2.pdbhor006679_ESM.pdb

Physical Information

Mass: 884438 Formula: C332H519N97O105S2
Absent amino acids: Common amino acids: G
pI: 7.36 Basic residues: 8
Polar residues: 27 Hydrophobic residues: 19
Hydrophobicity: -50.57 Boman Index: -13267
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 69.57
Instability Index: 5273.71 Extinction Coefficient cystines: 8480
Absorbance 280nm: 122.9

Literature

  • PubMed ID:  12093120
  • Title:  Molecular cloning of three cDNAs encoding different GnRHs in the brain of barfin flounder.